SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA09G0063400.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA09G0063400.1
Domain Number 1 Region: 165-222
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000863
Family B3 DNA binding domain 0.013
Further Details:      
 
Weak hits

Sequence:  ORGLA09G0063400.1
Domain Number - Region: 26-86
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00134
Family GABA-aminotransferase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA09G0063400.1
Sequence length 222
Comment pep:novel scaffold:1.0:Oglab09_0107:99222:102208:1 gene:ORGLA09G0063400 transcript:ORGLA09G0063400.1
Sequence
MTGILIYLHDNRCAISLGQSEVIEIKLCLLRILHMFSMDGDFGPLLELIELHRMYGLLLV
MDVPWTVGDHCDVGVIGLTKCSGTHGLLPCFDTFLLVSIQRETICVHPLDFMIWPQVKGK
CTNLATKATPTRIAIDGDRCSIDPSSPVCYSHFTATIMSSAVFASMRLNATNQSYLPVPI
TLATAYKMQHGDNLKLKTSHGLKIKIKIKEVASTLYMTTGWR
Download sequence
Identical sequences I1QNK5
ORGLA09G0063400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]