SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA10G0153900.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA10G0153900.1
Domain Number 1 Region: 17-75
Classification Level Classification E-value
Superfamily Photosystem II 10 kDa phosphoprotein PsbH 2.09e-28
Family PsbH-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA10G0153900.1
Sequence length 76
Comment pep:known scaffold:1.0:Oglab10_unplaced015:5389:5619:-1 gene:ORGLA10G0153900 transcript:ORGLA10G0153900.1
Sequence
MEFMATQTVEDSSRPGPRQTRVGNLLKPLNSEYGKVAPGWGTTPFMGVAMALFAVFLSII
LEIYNSSVLLDGILMN
Download sequence
Identical sequences E9KIR0 E9KIX8 I1PI00 U5PYC1
LOC_Os08g15296.1|PACid:21888975 LOC_Os08g15296.1|13108.m09262|protein 39947.LOC_Os08g15296.1 ORGLA03G0399600.1 ORGLA06G0239800.1 ORGLA06G0269400.1 ORGLA08G0205900.1 ORGLA10G0153900.1 ORGLA11G0191600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]