SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA11G0033600.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA11G0033600.1
Domain Number 1 Region: 35-130
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-30
Family B3 DNA binding domain 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA11G0033600.1
Sequence length 278
Comment pep:known scaffold:1.0:Oglab11_0031:192678:193728:-1 gene:ORGLA11G0033600 transcript:ORGLA11G0033600.1
Sequence
MAMNHPLFSQEQPQSWPWGVAMYANFHYHHHYEKEHMFEKPLTPSDVGKLNRLVIPKQHA
ERYFPLGAGDAADKGLILSFEDEAGAPWRFRYSYWTSSQSYVLTKGWSRYVKEKRLDAGD
VVHFERVRGSFGVGDRLFIGCRRRGDTAAAQTPAPPPAVRVAPAAQNAGEQQPWSPMCYS
TSGGGSYPTSPANSYAYRAADHDHGDMHHADESPRDTDSPSFSAGSAPSRRLRLFGVNLD
CGPEPEADTTAAATMYGYMHQQSSYAAMSAVPSYWGNS
Download sequence
Identical sequences I1QXU4
ORGLA11G0033600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]