SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA12G0150100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA12G0150100.1
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.43e-20
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 202-292
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.79e-16
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 3 Region: 558-660
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-16
Family B3 DNA binding domain 0.0084
Further Details:      
 
Domain Number 4 Region: 431-536
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000275
Family B3 DNA binding domain 0.0069
Further Details:      
 
Weak hits

Sequence:  ORGLA12G0150100.1
Domain Number - Region: 338-384
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00143
Family B3 DNA binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA12G0150100.1
Sequence length 661
Comment pep:novel scaffold:1.0:Oglab12_0214:187863:192981:1 gene:ORGLA12G0150100 transcript:ORGLA12G0150100.1
Sequence
MGDQKRSFINVMIGDFVAVPTKFANFIRGQISEVVKLEVPNGKTYDVQVAKEHNELVLRS
GWGAFARDYELKQCDILVFTYSGSSRFKVRIFNPSGCEKELSCVMMNNTPCGHEGSMSYH
DNHLQSPSESSLLFNISLPPHSPFQELSGVDSTSLLVSDPTNMQQFCLRCSWTNPKRLAK
PSLAIASLSHQHLAFDKTRCMFILKIENDTLKTILKMFAKNVQGLISGVAKLEVPDGKTY
DVEISKEHNELVFRSGWEVFAIAYELEQGDILAFGYSGNSHFKVQIFNPSNCEKELSCVV
MNRSISDDNHRQSPRRERMNKPSTTCMDCITNHYWLHMDDRERYFFKVMMSVSDIKDELA
IPKKFAANVRGKIPEQVRLEVSDDVPSSEDIKDPMSSGGLQKSKKSCYVLPMLYNMTSAQ
EAEVLALEKKIQPQIPLYITAMDKTSVASGSLVFSKDYAVRYLLDQNRTIKLCQSGGSKT
WDISLDMDTDDLYALSTGWLDFFRGNLLQEGDICVFEASMSKRGVALTFHPFKESHCPKS
SEYTLSTKSPTRRVPKRDYFATNLTNLTDQQERKCFSVKYASKYLPHKDQNMRLRLPETK
YKCKAALHIDTSTNLHKLLKGWGKFVNDNKLEIHDICLFQLMKNKKKLTMTVHIIRKGEC
S
Download sequence
Identical sequences I1R7J5
ORGLA12G0150100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]