SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA12G0150200.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA12G0150200.1
Domain Number 1 Region: 21-119
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.26e-23
Family B3 DNA binding domain 0.0013
Further Details:      
 
Domain Number 2 Region: 381-487
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.06e-19
Family B3 DNA binding domain 0.0085
Further Details:      
 
Domain Number 3 Region: 230-329
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-18
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA12G0150200.1
Sequence length 490
Comment pep:novel scaffold:1.0:Oglab12_0214:195191:197498:1 gene:ORGLA12G0150200 transcript:ORGLA12G0150200.1
Sequence
MEKSHRVCKNCVANHYWLHMDNHGKSFIKVMITDFKNGVTIPAKFARNFGGQMSGTVKLE
TRNGKTYEVQVAKELNNLVLRSGWERFASAYELEKGDILVFIYSGNSHFKVWIYDPSACE
KELPCIITEQLPRVQQRSISHNNHTQLKRNAKSAKLYVDSSGHSKETSEINPANSPSWKP
TERVPSSEELDEPVDLANVQKATKSFYSLPRMCNMTSAQKAEVDALEKRIKPQIPFYITV
MDKASATDGLLAISKDYAVSYLLDKNETIKLCHSGRSMTWDISLDIDTDDQYALSTGWLD
FIRNNHLQEGDICVFEASKNKRGVALIFHPLKQSHHPKPPGCVPSTKFPRHGVSKPNYIV
SRFTTLSGQLKIKVEAKVQAIQSEIPIFVAVMRESFIRGRSRYMCFSAKYAAKYLPREKN
KIMRLRLPNKSYKYKAVFKINNKVHKLGGGWGKFVDDNKIKLGDICLFQLMKNKKKLMMM
VHIIRKSEFC
Download sequence
Identical sequences I1R7J6
ORGLA12G0150200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]