SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA12G0159700.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA12G0159700.1
Domain Number 1 Region: 117-261
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-49
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 757-840
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000144
Family PB1 domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA12G0159700.1
Sequence length 899
Comment pep:known scaffold:1.0:Oglab12_0253:12577:17375:-1 gene:ORGLA12G0159700 transcript:ORGLA12G0159700.1
Sequence
MKLSPPASADMPQALPENDGEQRCLNSELWHACAGPLVSLPVVRSRVVYFPQGHSEQVAA
STNKEVDAQIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPEEQKEPFLPME
LGAASKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDN
EWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNDNNQLLLGIRRANRQQTVM
PSSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVG
MRFRMLFETEESSVRRYMGTITSISDLDSVRWPNSHWRSVKVGWDESTTGDKQPRVSLWE
IEPLTTFPMYPSAFPLRLKRPWASGLPMHGMFNGGGNDDFARYSSLMWLRDGNRGTQSLN
FQGHGVSPWLQPRIDSPLLGLKPDTYQQMAAAALEEIRSGDPSKQHPATLQYQQTHNLNS
GLNSLFASHVLGQVQFQPQQSPLQVVQQGHCQNTGDSGFLQGQLPRLQLHNTQQLLKEQE
LQQQQRQHVLQEQSNQEMQQQLPSSDHRVADVASESGSAPQAQSSLLSGSSFYNQNLLEG
NSYPPLHLHNNFHNFSNQEASNLLSLPRSSQLMASDGWPSKRLALESAVHPEAPSMHPKI
EKVNHQGISHFPGAFPPQSARGCSIVQDCRADAENRLLSSSFELQDGMTSIITDANRETD
TMAIPLLRYSGADLTTENTLATSNCLGESGTFNPLNNISVNPSQGATFVKVYKSGSLGRS
LDISRFSSYCELRSELERLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFANSV
WCIKILSPQEVQQLVRGGDGLLSSPGARMQQSNACDDYSASHNMQNIAGNIASVAPLDY
Download sequence
Identical sequences A0A0D3HWP7 I1R7U1
OBART12G18720.1 ORGLA12G0159700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]