SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA01G0057300.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA01G0057300.1
Domain Number 1 Region: 265-372
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.13e-16
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 50-190
Classification Level Classification E-value
Superfamily POZ domain 0.0000000141
Family BTB/POZ domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA01G0057300.1
Sequence length 580
Comment pep:known scaffold:1.0:Oglab01_0032:130955:135192:-1 gene:ORGLA01G0057300 transcript:ORGLA01G0057300.1
Sequence
MEPPTSHVTNAFSDSDSASVEEGGADADADVEALRRLSDNLAAAFRSPEDFAFLADARIA
VPGGGGDLRVHRCVLSARSPFLRGVFARRAAAAAAAGGGEDGGERLELRELLGGGGEEVE
VGYEALRLVLDYLYSGRVGDLPKAACLCVDKDCAHVGCHPAVAFMAQVLFAASTFQVAEL
TNLFQRRLLDVLDKVEVDNLLLILSVANLCNKSCMKLLERCLDMVVRSNLDMITLEKSLP
PDVIKQIIDARLSLGLISPENKGFPNKHVRRIHRALDSDDVELVRMLLTEGQTNLDDAFA
LHYAVEHCDSKITTELLDLALADVNHRNPRGYTVLHIAARRREPKIIVSLLTKGARPADV
TFDGRKAVQISKRLTKQGDYFGVTEEGKPSPKDRLCIEILEQAERRDPQLGEASVSLAMA
GESLRGRLLYLENRVALARIMFPMEARVAMDIAQVDGTLEFNLGSGANPPPERQRTTVDL
NESPFIMKEEHLARMTALSKTVELGKRFFPRCSNVLDKIMDDETDPVSLGRDTSAEKRKR
FHDLQDVLQKAFHEDKEENDRSGLSSSSSSTSIGAIRPRR
Download sequence
Identical sequences I1NL33
ORGLA01G0057300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]