SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA01G0213000.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA01G0213000.1
Domain Number 1 Region: 144-284
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-43
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA01G0213000.1
Sequence length 722
Comment pep:known scaffold:1.0:Oglab01_0215:471238:476224:-1 gene:ORGLA01G0213000 transcript:ORGLA01G0213000.1
Sequence
MVGIDLNTVEEEEDEEEGGATGTVTAPAEARAGGAVCLELWHACAGPVAPLPRKGSAVVY
LPQGHLEHLGAAPGSGPGAAVPPHVFCRVVDVSLHADAATDEVYAQVSLVADNEEVERRM
REGEDGAACDGEGEDAVKRPARIPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSL
QRPSQELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWSGFINKKKLVSGDAVLFLRGEDGE
LRLGVRRAAQLKNASPFPALHNQISNTSSLSEVAHAVAVKSIFHIYYNPSCTHRLSQSEF
IIPYWKFMRSFSQPFSVGMRFKLRYESEDASERRRTGIIIGSREADPMWHGSKWKCLVVK
WDDDVECRRPNGVSPWEIELSGSVSGSHLSTPHSKRLKSCFPQVNPDIVLPNGSVSSDFA
ESARFHKVLQGQELLGLKTRDGTVNTASQATEARNFQYTDERSCSINMSNNILGVPRLGV
KTPSGNPGFSYHCSGFGESQRFQEVLQGQEVFRPYRGGTLSDACIRGSGFRQPDGNHAPG
AAFKWLAPQGCDHHGITTSVLPQASSPSSVLMFPQTSSKMPGLEYIYGCLDRNENSRHFK
IGPTQDMTRTDQTLRLWPHLISGKMLDECTRNEKLHSPVGGAEHESNNKCLNTNGCKIFG
ISLTEKAQAGDEVDCGNASYHSRLQSLKPQMPKSLGSSCATVHEQRPVVGRVVDISAVNT
MI
Download sequence
Identical sequences I1NQJ0
ORGLA01G0213000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]