SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA01G0237800.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA01G0237800.1
Domain Number 1 Region: 67-165
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-18
Family B3 DNA binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA01G0237800.1
Sequence length 289
Comment pep:known scaffold:1.0:Oglab01_0233:11085:15561:1 gene:ORGLA01G0237800 transcript:ORGLA01G0237800.1
Sequence
MAGVTSKRRSSSASTSSSSGDGAAVSDRPRGVTRKRRSGGRCPRPAASLRPAAPRPSSHH
TAGLRVILQKELRYSDVSQLGRIVLPKKEAEAYLPILTSKDGKKSLCMHDLQNAQLWTFK
YRYWPNNKSRMYVLENTGDYVRTHDLQLGDSIVIYKDDENNRFVIGAKKAGDQQAATVPQ
VDEHISTLFPIFPIAQVDDYLSPMAPQVDISAFVPHADENHEIFDGILNSLPEIPVANVR
YSDFFDPFDDGMDMANTLNANANQSASLHVTDDKSGHSLIPNPKSGPHM
Download sequence
Identical sequences A0A0P0V7F2 I1NR88
ORGLA01G0237800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]