SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA01G0263100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA01G0263100.1
Domain Number 1 Region: 321-424
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.29e-18
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 78-129,158-239
Classification Level Classification E-value
Superfamily POZ domain 0.000000000118
Family BTB/POZ domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA01G0263100.1
Sequence length 635
Comment pep:novel scaffold:1.0:Oglab01_0259:152916:156220:1 gene:ORGLA01G0263100 transcript:ORGLA01G0263100.1
Sequence
MPARSAVVVVAMEPSSSITIASSSSYLSNGSSPCSVSLAPPGAGAVAAQAAPVAAXXXXX
XXXXXXGGGGSSSVEVVSLNRLSANLERLLLDSDLDCSDADVDVADGGPPVPVHRCILAA
RSTFFYNLFAARGRGGDGAAGGGGGGGGGGERTGGRPRYKMEELVPGGRVGRDAFLSLLG
YLYTGKLRPAPDDVVSCADPMCPHDSCPPAIRFNVEQMYAAWAFKITELISLFQRRLLNF
VDKTLVEDVLPILQVAFHSELTPVLEKCIRRIARSNLDNVSLDKELPPEVAVQIKEIRQK
SQPNEGDTVISDPVHEKRVRRIHRALDSDDVELVKLLLNESEITLDDANALHYAAAYCDS
KVVSELLDLRLANLNLKNSRGYTALHLAAMRREPAIIMCLLNKGAAVSQLTADGQSAMSI
CRRLTRLKDYNTKMEQGQESNKDRLCIDILDREMIRKPMAVEDSVTSPLLADDLHMKLLY
LENRVAFARLFFPAEAKVAMQIAQADTTPEFGIVPAASTSGKLKEVDLNETPVTQNKRLR
SRVDALMKTVELGRRYFPNCSQVLDKFLEDDLPDSPDALDLQNGTSDEQNVKRMRFCELK
EDVRKAFSKDRADNSMFSILSSSSSSSPPPKVAKK
Download sequence
Identical sequences I1NRZ1
ORGLA01G0263100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]