SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA01G0363100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA01G0363100.1
Domain Number 1 Region: 123-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-40
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 690-771
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000000365
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA01G0363100.1
Sequence length 810
Comment pep:known scaffold:1.0:Oglab01_0311:256:4840:1 gene:ORGLA01G0363100 transcript:ORGLA01G0363100.1
Sequence
MPPAAMAPPPPPQGSSTGDPLYDELWHACAGPLVTVPRVGDLVFYFPQGHIEQVGVEASM
NQVADSQMRLYDLPSKLLCRVLNVELKAEQDTDEVYAQVMLMPEPEQNEMAVEKTTPTSG
PVQARPPVRSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMTQSPPTQELVAKDLHSMD
WRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQLSNVP
SSVISSQSMHLGVLATAWHAINTKSMFTVYYKPRTSPSEFIIPYDQYMESVKNNYSVGMR
FRMRFEGEEAPEQRFTGTIIGSENLDPVWPESSWRSLKVRWDEPSTIPRPDRVSPWKIEP
ASSPPVNPLPLSRVKRPRPNAPPASPESPILTKEAATKVDTDPSQAQRSQNSTVLQGQEQ
MTLRSNLTESNDSDVTAHKPMMWSPSPNAAKAHPLTFQQRPPMDNWMQLGRRETDFKDVR
SGSQSFGDSPGFFMQNFDEAPNRLTSFKNQFQDQGSARHFSDPYYYVSPQPSLTVESSTQ
MHTDSKELHFWNGQSSVYGNSRDQPQNFRFEQNSSSWLNQSFARPEQPRVIRPHASIAPV
ELEKTEGSGFKIFGFKVDTTNAPNNHLSSPMAATHEPMLQTPSSLNQLQPVQTDCIPEVS
VSTAGTATENEKSGQQAQQSSKDVQSKTQVASTRSCTKVHKQGVALGRSVDLSKFSNYDE
LKAELDKMFEFDGELVSSNKNWQIVYTDNEGDMMLVGDDPWEEFCSIVRKIYIYTKEEVQ
KMNSKSNAPRKDDSSENEKGHLPMPNKSDN
Download sequence
Identical sequences I1NUU1
ORGLA01G0363100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]