SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA02G0195900.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA02G0195900.1
Domain Number 1 Region: 382-475
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.94e-16
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 961-1052
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000159
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA02G0195900.1
Sequence length 1053
Comment pep:known scaffold:1.0:Oglab02_0255:61701:67849:-1 gene:ORGLA02G0195900 transcript:ORGLA02G0195900.1
Sequence
MDDAVRGQGCVGRLRSFNKTKKKNRNCSDDMRNGDDEEKKKYSHHDMKKNLRNDANEEKR
KSSDDMRDGDFEEKKKCSRHDMKKNLRNDANGERRKSSDDMRDGDDEEKKCSRQDMKKNL
RNDADEEKRKSSDDMRDGDDEEKKKRSRHDMKKNSRNDADEEKRKRKRKRKRKCSDDLKK
SVLNDASKEATSHSDWRKNRKAGSDAEQRGKKLLNGDKKAKSRKVTTPFFEKMRKIKMQR
TSNQNGEKNMKSDGDSYKKTVPLSVNKGKMEKDGTNKRTLSNTLVAKERKMRPSDSMEMK
MKKKKRDASFVQPDERTAQTFSTKNKEKKRKAPSTPLKREQKERVASSDNKKETKKACIV
AIGNEKKNCRDGKKKKRKAAFAFFKFVRDEFEELLFIPPAVAPSLKDLIDRHVYLEDSEG
KCSKIRLSVVDGSLAFYEGWNSFVSEHCIKWGEFLLFEYTPESTFSVRVFGIDSCERLHF
SVKSGGKGAVKKRKERHTLSDDLISHYNGQYQDSEDIHDDPNVSGESPRSKEPKIAVDAE
IGTRNLVAKSINAASETQDSERVESGIGYGSLGALGNKVRNLSNGECDTRSDSVFCIQEK
TRRSEVIIISDEAYSTQVDEDTMKQTAPSEASEIHHVTINTQKDLERVVDGVCCESSVAL
NNKMGNLILGEPKNKNISPACSTEKTNGSEITPTTGAIPLTQENIDTVKLNTLSCFEEDR
STTRESELAAAIPTISETHDSDKDLGQKHQRNSVQVNSIIAVDKYLNDSEMNISGNIFRI
YEAPAGTRCLEKWKRGIVNGRAALDDIGQVRPEKTQKAGEKLVGNCGAMGESPVDLRIES
DVTDTCLKPILNIPIEELSILDSVSISKCGRSRTEVNHLFNQKGATVQLQTKKEPLKPTG
SSGNRKGDKIAVSVNRVFAHQSELQIPQQENGNFTSCVTPVALLPAKAELLDLDDHSLQF
CIPSTIQKWLELPKSLPITCRQKGRYDRNVVILKDPMRRLWPVFYHDKPVFVGFTAGWKP
FAAANNLQAGDVCKFVKEMDEDELAFQVYITRK
Download sequence
Identical sequences I1P1V3
ORGLA02G0195900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]