SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA02G0241100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA02G0241100.1
Domain Number 1 Region: 92-200
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.36e-29
Family B3 DNA binding domain 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA02G0241100.1
Sequence length 411
Comment pep:known scaffold:1.0:Oglab02_0312:21881:23116:-1 gene:ORGLA02G0241100 transcript:ORGLA02G0241100.1
Sequence
MEFTTSSRFSKEEEDEEQDEAGRREIPFMTATAEAAPAPTSSSSSPAHHAASASASASAS
GSSTPFRSDDGAGASGSGGGGGGGEAEVVEKEHMFDKVVTPSDVGKLNRLVIPKQYAEKY
FPLDAAANEKGLLLNFEDRAGKPWRFRYSYWNSSQSYVMTKGWSRFVKEKRLDAGDTVSF
SRGIGDEAARHRLFIDWKRRADTRDPLRLPRGLPLPMPLTSHYAPWGIGGGGGFFVPPSP
PATLYEHRLRQGLDFRAFNPAAAMGRQVLLFGSARIPPQAPLLTRAPSPLHHHYTLQPSG
DGVRAAGSPVVLDSVPVIESPTTAAKRVRLFGVNLDNPHGGGGAAAAAGESSNHGNALSL
QTPAWMRRDPTLRLLELPPHHHHGAESSAASSPSSSSSSKRDAHSALDLDL
Download sequence
Identical sequences I1P355
ORGLA02G0241100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]