SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA03G0243400.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA03G0243400.1
Domain Number 1 Region: 22-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-23
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 227-333
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.24e-18
Family B3 DNA binding domain 0.0053
Further Details:      
 
Domain Number 3 Region: 425-528
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-18
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA03G0243400.1
Sequence length 536
Comment pep:known scaffold:1.0:Oglab03_0056:151185:153895:1 gene:ORGLA03G0243400 transcript:ORGLA03G0243400.1
Sequence
MAGSGSCMKKSCVCCQKYLEHLDGKMNCFVRRMTADSRRSMIMPCKFVNHFGGDFSGTIK
LQSPNGILYVVEVTKCKNKTVLRCGWEAFVDAHHIEENDSLLFRRVENSRFEVLIFDSDD
CEKVFSCAGIRNTCKSIQEKSSSSCDDTAESSESEGFARNQKGSFSHRRKTANLASSSED
SGEDSPSEHESVESGDLETSQEPYVLSRRSYLSEFQKDKVDALIQEIQPETTAFVAIMRK
SNVQLPTPFLVISFCYAEVHFPHKSVTVTLQRPCKSKKWHPRFYKRKDARMNILRGSWVE
FVKDNRVQEQDICVFVPTKDARRNFTFTVHLLRVAAAYSRGGTGVDRAGSSLGRTDVKSA
SEISIKEEPIDQEENVSSRNRNGVSDESEEDEDSEGPAHPPYIVPCKSRLSRLQKKIVEE
KVRSIQSKFPVYVAIMKKSNVERSASRCQLELGARFAAAVHLPDRRQTVVLQRRGERWAT
VMQIRSGTRRLLISGWHRFVRDNRLRVGDICLFEFKTHERWRLTMAVHAIFREQCC
Download sequence
Identical sequences I1PDI8
ORGLA03G0243400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]