SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA03G0244100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA03G0244100.1
Domain Number 1 Region: 25-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-22
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 452-560
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-20
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 3 Region: 243-344
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-20
Family B3 DNA binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA03G0244100.1
Sequence length 563
Comment pep:known scaffold:1.0:Oglab03_0056:190243:193712:1 gene:ORGLA03G0244100 transcript:ORGLA03G0244100.1
Sequence
MAGQGSQMKKYCDCCKRYVDHSNGKMKCFHRQMSANFEHSMIIPNKFLDQFGGKISRTVE
LESPKGNVYVVKVSKHMNKTVLQCGWEAFVDAHQIEENDSLLFRHIENSRFTVLILDSNG
CEKVFSCSGKRRASGVQERNADPIDVSSSTHDDTAQSSGGERFARSESGSDSQHSKTAKL
AATCSSGGSGEEAKESSSSEHESSYDLVDPQIAPMPGYVLSRGTNLSEAHEEKLDMLVQE
IRPEIPLYVTTMKHSNVNSHHASLVIAKHYACAYFPRTSQTITLKWHGKNRKWHPKFYIR
KDQVGYILHGRWIDFVRHNHVKEGDICIFHLKNFNGRKFRATVHLLRETIPHSFGALHIP
KRFESRNGRMRLKMTDDRRVSSTECRRGTMEPSTTNVKKEADNEQCNNGQGKRQEPLNFD
VSVGSSKPYLTADRVSLTEEQFRKVEENVHSIQSEGPIYVSIMNKSNVGTDGLYIITLGR
QFATRYLPEGEQTLTLLTTGTGKAWQVKMRPRSGDARMFTLGWRDFVRDNRLQTEDICLF
QLMKNSERGLAMTVHIIRHSERS
Download sequence
Identical sequences I1PDJ5
ORGLA03G0244100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]