SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA03G0245000.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA03G0245000.1
Domain Number 1 Region: 28-128
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-23
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 247-340
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000196
Family B3 DNA binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA03G0245000.1
Sequence length 376
Comment pep:known scaffold:1.0:Oglab03_0056:256614:258443:1 gene:ORGLA03G0245000 transcript:ORGLA03G0245000.1
Sequence
MGMLKIGKNCSVCKEWQEHCYWSHMADDCKHFLTYMVGDFTESMIVPSRFANNFNGHISE
VVNLKSPSGKTWSIGVANSDTGELVLRSGWKEFVDANGVQENDCLLFRYSGVSSFDVLIF
DPSGCEKASPHFVENRGFGREEKSAGAEGGGRDGDKNGHHQHQLEMTPHKNSSRCRSIPS
ACKRGLFSDEIEQDHREEKKEGDDEDEDEDKDGEDRYYFCRHGGRVTEYNLSKGDKEEIS
RVPVPVEPGNPVLVKVIHASHLLSSRYSTVGVSPEFAGRYLGPAMAREVVMERGGGGGRG
DQWHVRFVRRESSRGFHGTGWRRFARDNGLLAHDVCLFELRLVDGAGAGDRLRRRPRPTM
AVHVLRRVRGRFVLIR
Download sequence
Identical sequences I1PDK4
ORGLA03G0245000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]