SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA03G0245100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA03G0245100.1
Domain Number 1 Region: 30-129
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-21
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 252-342
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000163
Family B3 DNA binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA03G0245100.1
Sequence length 380
Comment pep:known scaffold:1.0:Oglab03_0056:260540:262850:1 gene:ORGLA03G0245100 transcript:ORGLA03G0245100.1
Sequence
MGMLKIGKNCSVCKEWQEHCYWSHMADHSKHFLKHMVGDFTESMTVPARFANNFNGHISE
EVNLRSPSGETWSIGVANSDAGELVLQPGWKEFVDGNGIEEGDCLLFRYSGVSSSFDVLI
FDPSGCEKASPHFVGSHGFGRAENSAGAEQGGRSGRPTPPIVDGDNGHRHHLEMTLHRNS
CRSIPRACKRSLFSDETEAKENDGEDEDEDVVAAAEGGRYGEYYFSRHGRVAEYNLREED
REEISRVPVPVQPGNAVFVQVIHSSHVRSSKYCIVGVSPEFAGKYLGAVEREVVLKRASR
GGEWHVLFVHRQNTRGFYGAGWRQFAGDNRLVAHDVCLFELTMVDAAAGGGGNRRRRWSR
RPTMTVHVLRRVRGRFVLLR
Download sequence
Identical sequences I1PDK5
ORGLA03G0245100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]