SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA04G0248600.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA04G0248600.1
Domain Number 1 Region: 133-272
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.4e-45
Family B3 DNA binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 849-931
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000719
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA04G0248600.1
Sequence length 955
Comment pep:known scaffold:1.0:Oglab04_0321:171717:176479:-1 gene:ORGLA04G0248600 transcript:ORGLA04G0248600.1
Sequence
MASSQEKAKTGVLRNAAALLDEMQLMGETQGAKKVINSELWHACAGPLVCLPQRGSLVYY
FPQGHSEQVAATTRKIPNSRIPNYPNLPSQLLCQVHNITLHADKDTDEVYAQMTLQPVNS
ETDVFPIPTLGAYTKSKHPTEYFCKNLTASDTSTHGGFSVPRRAAEKLFPQLDYSMQPPN
QELIVRDLHDNMWTFRHIYRGQPKRHLLTTGWSLFVGAKRLKAGDSVLFIRDEKSQLLLG
VRRATRQQTMLSSSVLSTDSMHIGVLAAAAHAASSGSSFTIYYNPRTSPSPFVIPVARYN
KATYMQPSVGMRFAMMFETEESSKRRYTGTVVGISDYDPMRWPNSKWRNLQVEWDEHGYG
ERPERVSIWDIETPENTLVFPSSTLNSKRQCLPGYGVSVPGMEIGSANMSSFPRAQGNPY
GSLQHIPAVGSELAIMLLNQSGQTLGSPLSFHQSSYSSIIQNVKQNYIPPLTVSTSACLT
KQESLPSDDAQHQFHMANMQNGDLEGSEVQPVIDSISESKLNATSRDPRNTDSYTSRSTS
EQNSKGEPRGKTRRSKKGLPHKTVSEKSDLSSAPSWICDNQQVGLESKLVGCDEQVNCGN
IEDSSGALTQGNFVGQPHGHQVEQKGVLSPPKVESSKSPDGGKSVNSFPNQGCFSQFIDG
LDWMTQPSYYQDSNVIQPAGVSENIFSSSADIPPSMIADTMETFQASCLSDCLPNSIQEF
ISSPDLNSLTFLSPDMQNLEVQLQHDGSNLPSTSNSFVQMSFSEESASQSANLSGLHMES
THRSINTTSCSQPMSTGGFDAGMYSKLPRLKESQILSLPEIHTNSMGTSACSMDATEYSL
DRSAKPMKPPVRTYTKVQKQGSVGRSIDVTGFRNYHELRSAIACMFGLQGKLEHPGSSEW
KLVYVDYENDVLLVGDDPWEEFINCVRCIRILSPSEVQQMSENGMHVLNDCIQAA
Download sequence
Identical sequences I1PQL7 Q01K26 Q8S983
LOC_Os04g56850.1|PACid:21894611 LOC_Os04g56850.1|13104.m05928|protein ORGLA04G0248600.1 39947.LOC_Os04g56850.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]