SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA05G0069900.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA05G0069900.1
Domain Number 1 Region: 271-371
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000275
Family B3 DNA binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA05G0069900.1
Sequence length 476
Comment pep:novel scaffold:1.0:Oglab05_0026:72845:74275:1 gene:ORGLA05G0069900 transcript:ORGLA05G0069900.1
Sequence
MTVASSDEASRSVLRPAPPLKWEDEEAHGSSPGGGGSAGWAVDSGDQENGADLGPVIAVE
GLGGLVPQPEVAVVAVELLPQLVQEPGKVSPRIHEKANSGEGENGDGKYRVVYTAGRRKR
CLISPGGSDGDRITPRDLAVAFHGQEAGQVAPEAATAAIADGAGVAVDSVLTKMQELVNH
GSCGNGKNNVRKSRRIHMKQATAVPVSDELKNLHSQEAEAAHGKITDQSDCEIKKEPRQS
CMSSIVGSDDSHISGLSTRLQSLGINITSVTPILSKNVSSTDCHPNQARLLLSRHAVEGS
PLLGMLTPLEDALVHSSGLPIEVLDRYGCSYDMFLRYLDSTTSYRLIVQWRNFLEMSHMI
PGDLVKLGAFRFEGQLALTLLHYGNAGKAKKVLDRKLKEKKVESNSTVTEKSKELTSRET
EESKEELTSRKTDANDEESASSVAEAIKKKWPSEMLEAAETLLMLSCSGDKPKPSE
Download sequence
Identical sequences A0A0D3G4T6 I1PTK1
OBART05G08120.1 ORGLA05G0069900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]