SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA07G0096600.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA07G0096600.1
Domain Number 1 Region: 107-182
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.19e-17
Family Skp1 dimerisation domain-like 0.00043
Further Details:      
 
Domain Number 2 Region: 16-78
Classification Level Classification E-value
Superfamily POZ domain 0.00000000259
Family BTB/POZ domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA07G0096600.1
Sequence length 187
Comment pep:known scaffold:1.0:Oglab07_0083:60678:61241:1 gene:ORGLA07G0096600 transcript:ORGLA07G0096600.1
Sequence
MEADKSGEGEKAGGKTISFRCSDGQAFHMPVAAAMLSTAIRKMFDKYPSIDHGGVIELPH
QVSFGIFPKIKEYCTKHAKVDDKGNPTVSTNTGAAAASSSSTDDEDLKNWDKELVNMEVK
PLHDLLLVAHLLDIKGLFDITCRKVADMLKGKTSEEMRRSSTSATTSPRKKTRQSKEQNP
WVFPDPE
Download sequence
Identical sequences I1QA24
ORGLA07G0096600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]