SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA07G0176700.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA07G0176700.1
Domain Number 1 Region: 116-192
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.66e-28
Family Skp1 dimerisation domain-like 0.0000641
Further Details:      
 
Domain Number 2 Region: 48-108
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000746
Family BTB/POZ domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA07G0176700.1
Sequence length 195
Comment pep:novel scaffold:1.0:Oglab07_0143:47265:47852:1 gene:ORGLA07G0176700 transcript:ORGLA07G0176700.1
Sequence
MAAGKGKEGECDMAAAAAEAEKKGEGSTVSRGAAGERVVEDSGGGRRTIHLKSKDGKQHD
VTEASARLSKTIAGMILAGGGADQCIPTPDIDHETLRVVMQYCDKHAADDADEEDLKEWD
EDFVDELDQDALFDVIAAANYLDIDGLLDLTCKRVADTIKGKTPEEIRKEFNIVNDLSKE
EEEEIRRENPWAFEQ
Download sequence
Identical sequences I1QCC5
ORGLA07G0176700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]