SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA07G0177400.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA07G0177400.1
Domain Number 1 Region: 96-171
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 6.93e-21
Family Skp1 dimerisation domain-like 0.00035
Further Details:      
 
Domain Number 2 Region: 23-86
Classification Level Classification E-value
Superfamily POZ domain 2.08e-17
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA07G0177400.1
Sequence length 174
Comment pep:known scaffold:1.0:Oglab07_0143:70084:70608:1 gene:ORGLA07G0177400 transcript:ORGLA07G0177400.1
Sequence
MATGSGAAAAAAADAEEKESGSRMITLTSNEGKAFVVTEASARQSATIRSMVDDGGCVDK
GFPLPNVDSKTLARVIQYCDEHGNKEPHTVDERAALAKFDRDFIAELDADKAFLYDVTMA
ANYLHIQGLLALTTQCVADTIKGKTPEEIRTAFGIEYDLTAQDEKEIKEEDTHA
Download sequence
Identical sequences A2YNV7 I1QCD2 Q8LI46
39946.BGIOSIBCE025669 39947.LOC_Os07g43250.1 LOC_Os07g43250.1|PACid:21900535 OsIBCD043270 LOC_Os07g43250.1|13107.m04545|protein ORGLA07G0177400.1 XP_015646343.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]