SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA07G0177500.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA07G0177500.1
Domain Number 1 Region: 99-176
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 6.02e-22
Family Skp1 dimerisation domain-like 0.00025
Further Details:      
 
Domain Number 2 Region: 27-89
Classification Level Classification E-value
Superfamily POZ domain 1.53e-19
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA07G0177500.1
Sequence length 178
Comment pep:novel scaffold:1.0:Oglab07_0143:77176:77712:1 gene:ORGLA07G0177500 transcript:ORGLA07G0177500.1
Sequence
MEGEDAVVPEAVAADAEKAEEKESGSRMITLKSNEGKAFVVTEASARQSTTIGHMIDDDC
TREAVPLPNVDSKTLEKVIEYFDEHANNKADTDDEKAALDKFDKDFIGELDGDKTFLFHV
TMAANYLHAQGLLDLTTQCIADTIKGKTPEEIRTAFNIAYDLTEEDQEEIKEEDAWAF
Download sequence
Identical sequences I1QCD3
ORGLA07G0177500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]