SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA08G0183900.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA08G0183900.1
Domain Number 1 Region: 122-261
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.84e-42
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 1010-1077
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000307
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA08G0183900.1
Sequence length 1116
Comment pep:known scaffold:1.0:Oglab08_0179:63801:70057:-1 gene:ORGLA08G0183900 transcript:ORGLA08G0183900.1
Sequence
MASSGGGGGGGEEGEGRGATKVNQELWYACAGPLVSLPPQGSLIVYFPQGHSEQVAASMR
KDADAQIPSYPNLPSKLICILHSVTMLADPDTDEVYARMTLQPVSNVTQCDKETLLASEL
ALKQTRPQTEFFCKTLTASDTSTHGGFSVPRRAAERIFPRLDFSMQPPAQELQARDLHDN
VWTFRHIYRGQPKRHLLTTGWSLFVSGKRLLAGDSVLFIRDAKQQLLLGIRRANRQPTNL
SSSVLSSDSMHIGILAAAAHAAANNSQFTIYYNPRASASEFVIPFAKYQKAVYGNQLSLG
MRFRMMFETEESGTRRYMGTITGISDLDPVRWKTSHWRNIQVAWDEAAPTERRTRVSLWE
IEPIIAPFFIYPSPLFTAKRPRLPGMTDDETEMDGLLKRAMPWVGEEICKKDLNIQNSVV
PGLNLAQWMNMQHSSSLPGTVVQPELLNSLSGKPVQNLAAADLSRQISFHTQFLQQNNIQ
FNTALVPQQNQQTEQLAKVIPTPNQLGSVIIPQKVVQDCNSEQRQHVVTQPVQGSQPNIN
IPQPQLVVQAQLQQPQVILQAQLQQPQVVVQAQLQQTQPSVQSHTVLQGGLQQIQLLQQQ
QPHVQHQQIPQQLHHQQQQTQQLQPVQQVQQSVQEHQQIKIQPVHVSMDASMNTQVADHQ
MKLQLLKALQPQQPLISEQQKMLLDLQQQVINSQSAPQQCVQVTNQAISLHNSNTIQYPT
QQKVQSHQVQDLTGNVIPNSKSDIATSMGASSLHVAGGRQLLKTDDVPSTSTSPSTNSNP
VLLQSIPSSSKNQSLTTAGKTSQSSVVLGPTIEQDTKPYQNVKQTVMIPKTTEQRPATGQ
DCINNNPQMDYLDTSSSATSVCLSQADGSLQQNFPPSSFHQHHLLKDTVPDSEFEVTDPR
NNLLFGVNIDGQLGLPLNADLLANDIGTDKYMDQLPGNGISNFISSKDSQQELSSSMISH
SFGVADMAFNSIDSAINDTPFLNRNSRSAAGPAHQRMRTYTKVHKRGAVGRSIDINRYSG
YDELKHDVARMFGIEGQLGDQNRVGWKLVYEDHEKDVLLVGDDPWEDFVKCVRCIRILSP
QEEMQMRLVGDFGDSFLPNQACSSSDGGHPWRITGD
Download sequence
Identical sequences I1QK88
ORGLA08G0183900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]