SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA09G0027500.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA09G0027500.1
Domain Number 1 Region: 82-157
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.19e-26
Family Skp1 dimerisation domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 15-109
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000122
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA09G0027500.1
Sequence length 160
Comment pep:known scaffold:1.0:Oglab09_0046:27595:28077:1 gene:ORGLA09G0027500 transcript:ORGLA09G0027500.1
Sequence
MAAADGTTGEEVKKTIDLVSNDGERFEVARDAALLCKTLRWMIKGGYGRIPLPSVASPIL
ARVVDYLARHAAAAAAMDDDGLDRFDRDFLAGVDQDTLFDLLLAANYLQADGLLDLACKK
VAAMMTGKSPEQMREIFHIVNDLTPEEEKEIREDIAWALN
Download sequence
Identical sequences A0A0D3H4H3 I1QMJ6
OBART09G03200.1 ORGLA09G0027500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]