SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA09G0142200.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA09G0142200.1
Domain Number 1 Region: 98-173
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.11e-32
Family Skp1 dimerisation domain-like 0.0000248
Further Details:      
 
Domain Number 2 Region: 10-69
Classification Level Classification E-value
Superfamily POZ domain 3.66e-20
Family BTB/POZ domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA09G0142200.1
Sequence length 175
Comment pep:novel scaffold:1.0:Oglab09_0183:195133:197425:-1 gene:ORGLA09G0142200 transcript:ORGLA09G0142200.1
Sequence
MAAEAETKAMITLRSCEGQVFEVAEAVAMESQTIRHMIEDKCADTGIPLPNVSAKILSKV
IEYCSKHVEARGGAAAAADGDAPAPAAVEANKAVEDELKTFDSEFVKVDQSTLFDLILAA
NYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
Download sequence
Identical sequences I1QQU3
ORGLA09G0142200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]