SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA09G0173800.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA09G0173800.1
Domain Number 1 Region: 88-163
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.22e-24
Family Skp1 dimerisation domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 15-75
Classification Level Classification E-value
Superfamily POZ domain 7.22e-19
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA09G0173800.1
Sequence length 166
Comment pep:novel scaffold:1.0:Oglab09_unplaced015:10675:11175:-1 gene:ORGLA09G0173800 transcript:ORGLA09G0173800.1
Sequence
MASAAAADVAADGKKMILLVSSDGVKFELSEAAASLSKTLGNMIEDDCATNGAIPLANVA
SDILAKVVEYCNKHAAAAAAKASGEEELRRFDAEFVNIDRKKLFGLINAANFLDMPCLLE
LTCQRAADFIKDMMPEQVRKVFGIENDFTPEEEAEVRNENAWAYEI
Download sequence
Identical sequences I1QRQ9
ORGLA09G0173800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]