SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORGLA09G0173900.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA09G0173900.1
Domain Number 1 Region: 87-162
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 7.06e-29
Family Skp1 dimerisation domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 14-72
Classification Level Classification E-value
Superfamily POZ domain 1.49e-18
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA09G0173900.1
Sequence length 165
Comment pep:novel scaffold:1.0:Oglab09_unplaced015:15954:16451:-1 gene:ORGLA09G0173900 transcript:ORGLA09G0173900.1
Sequence
MAAVKEGADAGDSKILLISSDGQHFQVTEAEASMSKLVSNMIEDECTENGVPLPNVASNV
LAKVLEYCKKHAAAATAEDIAVKDQELKSFDASFIDVDNTMLFGLILAANYLNVPSLLDL
ACQHMADLIKGKTVQEIRDTFGIVNDFTPEEEEEIRKENEWAFEN
Download sequence
Identical sequences I1QRR0
ORGLA09G0173900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]