SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA10G0047100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA10G0047100.1
Domain Number 1 Region: 52-132
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000171
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 192-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000167
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA10G0047100.1
Sequence length 272
Comment pep:novel scaffold:1.0:Oglab10_0084:85635:87940:1 gene:ORGLA10G0047100 transcript:ORGLA10G0047100.1
Sequence
MVPDQDGELRHDVCSLSTSLRLTAHVTSSIVHEQSSNIRYGENRKHGQRYAYHEPLPPEI
VARCNGHNGKHLTLVTRNSKPVNVRLEKRGQSFYISKGWKKFVELTDLRVGQCVRFSVSS
PSTLDLLILDKHGTSLAIPPSKRDLKLKSKRSTHQDSKGHPSNTDPGPSRIINRRVTKSE
SSANTQLLVQYFSKRYSIDHLEQLMTGRTEDIEVQTLVGPSVNMVLHTSTDHRCNLKKGW
TDFALSNGIKLNTVCIFHFYKTTHLGVIVDIF
Download sequence
Identical sequences I1QTD8
ORGLA10G0047100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]