SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA10G0098900.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA10G0098900.1
Domain Number 1 Region: 142-217
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.4e-27
Family Skp1 dimerisation domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 40-100
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000392
Family BTB/POZ domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA10G0098900.1
Sequence length 220
Comment pep:known scaffold:1.0:Oglab10_0117:64444:65220:1 gene:ORGLA10G0098900 transcript:ORGLA10G0098900.1
Sequence
MASTTAAAEDHKGKRPLPPEEADEAAAAPPPAAAEEEGEKLVLVSDDGVEVLASVAAARV
SKTLRGMIEDECATGAIPIAGVHSDVLALLVEYCERHAPHYDPEASDRDRYPFPPFPVEL
PPTASSIKPVTFVDPDADPHGLKAFDKKFLDVDNSTLFEIIMAANYLNIEELLDDACTAV
ADKMRGKKPEEIRDIFEIENDYTPEQEAEVRRENAWAFED
Download sequence
Identical sequences A0A0D3HE20 A0A0E0QZK0 I1QUV6 Q7XE44
ORGLA10G0098900.1 39947.LOC_Os10g30200.1 XP_015613361.1.37577 LOC_Os10g30200.1|13110.m02595|protein LOC_Os10g30200.1|PACid:21886448 OBART10G11220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]