SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA12G0033700.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA12G0033700.1
Domain Number 1 Region: 33-127
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.19e-30
Family B3 DNA binding domain 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORGLA12G0033700.1
Sequence length 277
Comment pep:novel scaffold:1.0:Oglab12_0025:261867:262841:-1 gene:ORGLA12G0033700 transcript:ORGLA12G0033700.1
Sequence
MAMHPLAQGHPQAWPWGVAMYTNLHYHHHYEREHLFEKPLTPSDVGKLNRLVIPKQHAER
YFPLGGGDSGEKGLLLSFEDESGKPWRFRYSYWTSSQSYVLTKGWSRYVKEKRLDAGDVV
HFERVRGLGAADRLFIGCRRRGESAPAPPPAVRVTPQPPALNGGEQQPWSPMCYSTSGSS
YDPTSPANSYAYHRSVDQDHSDILHAGESQRDADAKSSSAASAPPPSRRLRLFGVNLDCG
PEPEADQATAMYGYMHHQSPYAAVSTVPNYWSVFFQF
Download sequence
Identical sequences A0A0D3HRM6 A0A0E0J6Z5 I1R481
OBART12G03490.1 ONIVA12G03130.1 ORGLA12G0033700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]