SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA12G0109100.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA12G0109100.1
Domain Number 1 Region: 141-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-41
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 715-789
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000589
Family PB1 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA12G0109100.1
Sequence length 841
Comment pep:known scaffold:1.0:Oglab12_0166:12294:18035:-1 gene:ORGLA12G0109100 transcript:ORGLA12G0109100.1
Sequence
MAAAATAAASPVEGLTGGGGGGGGGVDGLFVELWRACAGPLVTVPAVGERVFYLPQGHIE
QVEASTNQVAEQQGAPLYNLPWKIPCKVMNVELKAEPDTDEVYAQLTLLPEKQQDGNGSG
NGYVSKDKVEEEEVVPPAATERPRVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMS
QHPPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFLRGENG
ELRVGVRRAMRQQANIPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPRTSPSEFVVP
RDLYEESLKRNHSIGMRFKMTFEGEEAAEQRFTGTIVGVGDSDPSGWADSKWRSLKVRWD
EAASVPRPDRVSPWQIEPANSPSPVNPLPAPRTKRARPNVLASSPDLSAVNKEVASKVMA
NSQQNGLPRAFHSQENMNLRSRFGDSNELNTSQKLTTWSSGSNQEKNNVSVQRELGSQSW
MQMRRPDGSSEILSGFQPLKDTRNPLSSFPSQISGNRSNTWNTINVHYPDQNVNHNMYPG
TWSLMPPNTGFGVNQQNYLMTPDITLPQRSLNAKFGGNGAFTSLRAHGIDQRSSGWLGHI
EPSSHIDDASSSLIKPQPLVIDHNVQKAKGSSCMLFGISLDSPAKPELLISPPSVAFDGK
LQQDALEEDECSDPSKTVKPLDGAQHDSATEKHQSCPDGTKNIQSKQQNGSSRSCKKVHK
QGIALGRSIDLTKFTCYDELIAELDQMFDFNGELNSSSKNWMVVYTDNEGDMMLVGDDPW
NEFCNMVHKIFIYTREEVQKMNPGALNSRSEDSRSTSVERGLVGEGLQGGLSTPSLNSEN
C
Download sequence
Identical sequences I1R6D5
ORGLA12G0109100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]