SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA12G0150300.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA12G0150300.1
Domain Number 1 Region: 241-342
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-21
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 21-124
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-18
Family B3 DNA binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORGLA12G0150300.1
Sequence length 354
Comment pep:known scaffold:1.0:Oglab12_0214:198857:200535:1 gene:ORGLA12G0150300 transcript:ORGLA12G0150300.1
Sequence
MGEKGCESCRKWQEHYYREHMDVSRIRFFRLMTGDFAHGISIPEKVAEIFSGQITKGFNL
KSPSGETWRVGVAKVADELILKSGWEDFAKAHELQENDLLFFTCNGHGNGSCSFDVLIFD
ASGCEKVSCFFTGKKNSYMCKNFNSIGGQVAGQYLSSDSEDTSTPSVLIGSPHKASTSKK
LSGKTKTNPRKEPEDPNCSHWHVIEEKNTDDDEHADYHYTRFANYLTGEERDEIFSLVSL
QPGNPVFVVVLQTAHVRRRNILIVPTRFAADHLERKSHDILLIRPNRKQKWSVKYYYLSN
TTRGFNCHRWIKFIRENRLREGNVCIFELMKGARRPTMTVHVIGKADNRFVLLG
Download sequence
Identical sequences A0A0E0GVZ8 A0A0E0RJF4 A2ZM93 I1R7J7
OsIBCD035532 ONIVA03G41670.1 ORGLA12G0150300.1 39946.BGIOSIBCE037170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]