SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORGLA12G0150600.1 from Oryza glaberrima

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORGLA12G0150600.1
Domain Number 1 Region: 253-356
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-18
Family B3 DNA binding domain 0.0098
Further Details:      
 
Domain Number 2 Region: 21-124
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-17
Family B3 DNA binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORGLA12G0150600.1
Sequence length 366
Comment pep:known scaffold:1.0:Oglab12_0215:2828:4814:-1 gene:ORGLA12G0150600 transcript:ORGLA12G0150600.1
Sequence
MGEKGCESCREWQEHCYREHMDVSRIRFFRLMTGDFAHGISIPEKVADRFSGQITKGFNL
KAPSGETWCVSVEKVADELILMSGWEDFAKAHELQENDLLFFTCNGRCNGSFSFDVLIFD
ASGCEKVSCFFIGKKNSIGGQTQNAEQYHLSDSEDTSTPSTFLVGSPHKASTSKKLNGKT
KTNPNKDDPFSTGKEPEDPNSSRSHVKHEMIEEEKSDDDDEHADYEHADYYYSRFANYLT
GEEREEIFSLVSLQPGNPVFVTVLQAPQIHRKGLLIVPSGFAADHLDSRSQEILLMRPNK
KEKWYVKYYHASTTRGFNCQRWIKFIRENRLREGYICIFELMKGARRVTMTVHVIGKVDD
RFVLLG
Download sequence
Identical sequences I1R7K0
ORGLA12G0150600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]