SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386749982|ref|YP_006223189.1| from Helicobacter cetorum MIT 00-7128

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386749982|ref|YP_006223189.1|
Domain Number 1 Region: 10-177
Classification Level Classification E-value
Superfamily PEBP-like 1.57e-32
Family Prokaryotic PEBP-like proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386749982|ref|YP_006223189.1|
Sequence length 182
Comment hypothetical protein HCW_06495 [Helicobacter cetorum MIT 00-7128]
Sequence
MQFFSVCIETDPKGYLDAKFGGNAPKEFLNENGLPTYSPKISWQKIENAKSYALELIDHD
AQQVCGMTFIHWVVGNISNNVLEENASIMNKEIIQGVNSLTQGFVRSTLNESEKQHSNAN
NSVYIGPMPPNGDHHYLIQVYALDIPKLELQPFFFLGDLHDKMRGHIIAMGRTEFLYKQC
IR
Download sequence
Identical sequences I0ENP0
gi|386749982|ref|YP_006223189.1| WP_014661427.1.61185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]