SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018283 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000018283
Domain Number - Region: 41-210
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0575
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018283   Gene: ENSONIG00000014530   Transcript: ENSONIT00000018300
Sequence length 237
Comment pep:novel scaffold:Orenil1.0:GL831142.1:306039:316789:1 gene:ENSONIG00000014530 transcript:ENSONIT00000018300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPTSSPSWFSALIKCLPIFCLWVFLLAHGFT
FLCAHSSARKILAGLIFSALGDAFLIWQEQGYFVHGLLMFAITHILYSSAFGMKPINVRA
GLVITAVSFLCYILLYPYLSGPFTYLVAVYIALIGFMGWRAIAGLQLANDLWTWTKLSAC
LGAVLFMVSDLTIAVNKFCFPVPHSRAIIMATYYAAQMLIALSAVECQDVEVARKRT
Download sequence
Identical sequences I3KAY8
ENSONIP00000018283 ENSONIP00000018283 XP_003440534.1.78416 XP_004563434.1.88231 XP_005942930.1.24487 XP_006789639.1.46954 XP_014195754.1.24487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]