SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025897 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025897
Domain Number 1 Region: 6-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.25e-29
Family G proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025897   Gene: ENSONIG00000020592   Transcript: ENSONIT00000025918
Sequence length 239
Comment pep:novel scaffold:Orenil1.0:GL831561.1:23584:24303:-1 gene:ENSONIG00000020592 transcript:ENSONIT00000025918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVNCVSGPDLRIVMIGKTGVGKSTVGNTIMGEKCFISRPTSESVTRSCQKGVTQWGNRVV
SVVDTPGILDTKVTEDFIQKEIVRCVEVSCPGPHVFLLVIQVGRFTREEKNSVEALQELF
GPQANKYMIVLFTRGGDLGGMTIQEYVREGSADLRRVIQSCGNRFHVFDNTSSDKNQVVE
LIKKIDGMMARNGGRYYTDAMYREVEAAQRRGPLGKFLYGFIGGLMQRIRKFIEILGKD
Download sequence
Identical sequences I3KXQ1
ENSONIP00000025897 ENSONIP00000025897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]