SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003139 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003139
Domain Number 1 Region: 400-509
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-24
Family PDZ domain 0.0074
Further Details:      
 
Domain Number 2 Region: 18-127
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-21
Family PDZ domain 0.00018
Further Details:      
 
Domain Number 3 Region: 208-314
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-17
Family PDZ domain 0.036
Further Details:      
 
Domain Number 4 Region: 686-799
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000814
Family Nucleotide and nucleoside kinases 0.0011
Further Details:      
 
Domain Number 5 Region: 511-578
Classification Level Classification E-value
Superfamily SH3-domain 0.000000805
Family SH3-domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000003139
Domain Number - Region: 886-947
Classification Level Classification E-value
Superfamily Plus3-like 0.0981
Family Plus3 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003139   Gene: ENSONIG00000002505   Transcript: ENSONIT00000003140
Sequence length 960
Comment pep:novel scaffold:Orenil1.0:GL831140.1:5758020:5775748:1 gene:ENSONIG00000002505 transcript:ENSONIT00000003140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLTERLKRLKHLGSVPPEPPPLLVVPKPGMEEITIWEQHTITLNKDSKLGFGFAISGGR
DKPQPDGDTSIMVSDVLPNGPAMGRLFTKDQIVMVNGEPMDNVHSNYTIQTLKSCGKTAN
ITVKRPRKIQIPTPSSTRPTRAASHSNLLDADPPRRQRRHSDGSDNMDSNRYRADDRYRA
DDRYRTNDRYPRRSPSPERNGLTNAMPLMSSGYKRLPHNDVSEKPIRTTLIKKKTTDEYG
LKLGSQIFIKHMTETGLAAREGTLQEGDLILKINGMTTENLSLLETKHLVEKSRGKLTMT
VLRDDRRFLVSIPEVEDSPQNSDYDHHKDSSSELEDRTKAEPPLPKSRDQSPVRSTLSRP
PVKAYAPRRDSDSESDGFSEPPQRRSTTYSQDSLSRYSYSQKKEKEDHRYSSDVKTVSFI
KESSLGLRLVGGNDVGIFVGGVQPHSPAYENGMKEGDQIMQVNKVDFGHFTREEAANFLL
ELRTGERVEISTQHKMDIYKKILKSNLGDNFYIRTHFDHDPDSPIGLGFTRGEVFRVVDT
MHRGKIGNWLAIRMGNDLHEMDKGTIPNQIRAEKMASIEKAQRGTGERQASGPRAEFWKL
RGLRGNKKNEKNMRRSREDLLQLTIQGKFPAYERVLLREANFKRPIVILGPLNDIAMEKL
TREMPDEYEVAEMVPRSGSADGSSTVIKLDTVRRIAEKDKHPLLDITPTAVERLNYIQYH
PMVLFLDPHNRKDVKTMRQRYSPNSSKSSRRLYSQAIKMKKHCSHLFSARVDLDPSSHSW
YESLKNKIRHEQTKPVWVSEVTLESGGEQDLDALDQNQTDYLSAASDLEDTDGEGFTDDA
YTDNEELEEAYPGQDAPKVPGGSRVAGAALARSSEPAFEHHSPSIEPEESDDAYGVREVP
PIMHVPEPRSPRQAWSDDMLWLAHHHQAVQFRRTQIQGSDSSEDEFDDADDMEWGPATEL
Download sequence
Identical sequences I3J2P9
ENSONIP00000003139 ENSONIP00000003139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]