SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005474 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005474
Domain Number 1 Region: 14-124
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.01e-19
Family G proteins 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005474   Gene: ENSONIG00000004342   Transcript: ENSONIT00000005478
Sequence length 125
Comment pep:novel scaffold:Orenil1.0:GL831197.1:2432091:2434724:1 gene:ENSONIG00000004342 transcript:ENSONIT00000005478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVIVSHIFSRFFSKHPVRILMVGLDAAGKTTLLYKLKLEYQSETIVKVGSIVLLQLQED
ELKGVAVLVFANKQDLPRAMSVSDIIEALSLKGVSQPWSIQPSCAVSGTGVVEGLDWLSN
EILKQ
Download sequence
Identical sequences I3J9D4
ENSONIP00000005474 ENSONIP00000005474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]