SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010003 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010003
Domain Number 1 Region: 451-765
Classification Level Classification E-value
Superfamily RNI-like 1.08e-46
Family 28-residue LRR 0.00039
Further Details:      
 
Domain Number 2 Region: 776-950
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-45
Family SPRY domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000010003
Domain Number - Region: 75-199
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0138
Family Nitrogenase iron protein-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010003   Gene: ENSONIG00000007940   Transcript: ENSONIT00000010011
Sequence length 956
Comment pep:novel scaffold:Orenil1.0:GL831510.1:265484:279925:-1 gene:ENSONIG00000007940 transcript:ENSONIT00000010011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKKKFQCVFEGIAKAGNPTLLNQIYTELYITEGGTAEVNDEHEVRQIETASRKPDRPERT
IRQEDIFKGSPGRDEPIRTVLTKGVSGIGKTVLIQKYSLDWAEDKANQDIQFIFPFTFRE
LNVLKEEKFSLVELVHHFFTETKEAGICRFEDFQVVFIFDGLDECRLPLDFXMVTEVRGF
TDPQKEEYFRKRFGDEEQASKIISHIKSSRSLHIMCHIPVFCWITATVLEDVLKTREGGQ
LPKTLTDIYIHFLVVQAKVKKVKYDGRAETDPHWSPESKKTIESLGKLAFEQLQQGNLIF
YESDLTECGIDIRAASVYSGVFTQIFMYQDKVFCFIHLSVQEFLAALHVHLTFINSGLNL
LEEQQTTSKKSDLFGKKRHFQSFYRSAVDKALQSPNGHLDLFLRFLLGLSLQTNQTLLRG
LLTQTRSNSRTNRKTLQYIKTKLSEKLSSEKTINLFHCLNELNDRSLVEEIQQSLSSGSL
STDELSPAQWSALVFILLSSEKDLDVFDLKKYSASEEALLRLLPVVKACNKALFLFLFFY
LAINCLRTHSKKNLKFSHDLVTESNSCSADRIVKVLSDPGHHSLRRSFFRLSACNLSETS
CEALSSVLSSQSSSLRELDASNNNLQDPGVKLLSVGLQSQHCTLETLRLSGCDLTKKSCE
SLSSILSSQPCSLRVLDLSDNNLQDSGVEILSAGVRSPYCKLETLSLSGCLITEEGCTSL
ATALSSNPSYLRELDLSYNHPGNSGMKLLSAGRKDPRWRLDILKVEPAGVRWLTPGLRKY
SCQLTIDTNTVHTNLQLSDNNRKVTHAEEVQSYPDHPDRFDVYEQLLCRDGLTGRCYWEV
EWRGDVEISVSSRKIRRKGDSTDCLFGWNDQSWSLICSGDRPRSVRQNKTEKSISSSSYS
VCNRVAVYVNCPAGTLSFYRVSSDTLIHLHTVNTTFTETLYPGFWFRSPGSSVCLC
Download sequence
Identical sequences I3JMA9
ENSONIP00000010003 ENSONIP00000010003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]