SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012617 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012617
Domain Number 1 Region: 375-504,540-592
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.75e-39
Family Hemopexin-like domain 0.00091
Further Details:      
 
Domain Number 2 Region: 63-102
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000034
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 22-62
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000123
Family Somatomedin B domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012617   Gene: ENSONIG00000010033   Transcript: ENSONIT00000012627
Sequence length 612
Comment pep:novel scaffold:Orenil1.0:GL831168.1:3981480:3988234:-1 gene:ENSONIG00000010033 transcript:ENSONIT00000012627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLLCTLIFLACALTFSGAQTSCRGRCGGEYYRGYRCQCDYNCLSYGECCNDFESQCT
TKNSCKGRCGESFKRGRLCSCDSDCIKYNQCCSDYKNHCDAQDDSSVPPVGPTSHPPDDP
TDDVSGTIFPTDEFSTTEPEDLEASPVPEISIDYELSTVDPLGEISTEATPTTARTPSDN
DDLVSTTAEALSDSTTADHTSSEPMSTLIPSVEPSSSTSSPQLDTQTPAVTIMDAVFPSD
EPDNSLLTITPASTTIPDEPTSTHPEDVSASSPSVLPSTSASSVGSEEISMVEAVTTHAP
SPTTAAWTDATDDLLTDTSKPTRAQEPEPTPPVEKPELYELDPAKPISKPDTKPLETQNI
DDTGDYQADDNNDTNLCSGRPVSGVTTLRNGTMVVFRGHYFWLLDSNRVPGPPRGITQVW
GVPSPIDTVFTRCNCQGKTYIFKGSQYWRFENDALDHGYPKVITTGFDGLRGHITAALSV
PQYKSRAESVYFFKRGGFVQKYSYHAGVGPTCRKKVQYAIYTVRNRVVRQAAPLLGPAIT
IRTSWRGFPPAITAAVSVPTTTEPEGYKYFVFSGSKSYNVRLDGERPVIAPPTASSSPQS
NNFIRCLQKEKL
Download sequence
Identical sequences I3JUS2
ENSONIP00000012617 ENSONIP00000012617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]