SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018466 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018466
Domain Number 1 Region: 17-182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.31e-46
Family G proteins 0.0000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018466   Gene: ENSONIG00000014667   Transcript: ENSONIT00000018483
Sequence length 187
Comment pep:novel scaffold:Orenil1.0:GL831175.1:1250283:1257725:1 gene:ENSONIG00000014667 transcript:ENSONIT00000018483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIALINKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKI
TKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADPEKIEASKNELHNLLDKPQL
QGIPVLVLGNKRDLPGALDEKELIERMNLSAIQDREICCYSISCKEKDNIDITLQWLIQH
SRTKRSS
Download sequence
Identical sequences A0A096M2I0 A0A1A7Y073 A0A1A7ZQ45 A0A1A8DYE9 A0A1A8H2V4 A0A1A8IES4 A0A1A8MKJ3 A0A1A8QYR2 I3KBH1
XP_003446018.1.78416 XP_003963067.1.43653 XP_004573304.1.88231 XP_005814059.1.87360 XP_005936628.1.24487 XP_006806343.1.46954 XP_007578280.1.10163 XP_014831229.1.96476 XP_014878517.1.100837 XP_015824325.1.37898 XP_017161471.1.1237 XP_017260546.1.84151 XP_018526662.1.34915 XP_020474603.1.23826 ENSONIP00000018466 ENSONIP00000018466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]