SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022720 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022720
Domain Number 1 Region: 2-165
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.5e-52
Family G proteins 0.0000000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022720   Gene: ENSONIG00000018029   Transcript: ENSONIT00000022740
Sequence length 186
Comment pep:novel scaffold:Orenil1.0:GL831195.1:3310445:3315174:-1 gene:ENSONIG00000018029 transcript:ENSONIT00000022740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAG
TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDL
EVERVVAKESGIGLARQWNSCAFLETSAKSKINVNEIFYDLVRQINRKSPVPGKTRKKST
SSATLL
Download sequence
Identical sequences I3KNM5
ENSONIP00000022720 ENSONIP00000022720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]