SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025651 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025651
Domain Number 1 Region: 927-1031
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-25
Family PDZ domain 0.000091
Further Details:      
 
Domain Number 2 Region: 1077-1182
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-25
Family PDZ domain 0.00013
Further Details:      
 
Domain Number 3 Region: 359-466
Classification Level Classification E-value
Superfamily PDZ domain-like 1.09e-23
Family PDZ domain 0.0000258
Further Details:      
 
Domain Number 4 Region: 736-852
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-22
Family PDZ domain 0.00045
Further Details:      
 
Domain Number 5 Region: 539-643
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-21
Family PDZ domain 0.00025
Further Details:      
 
Domain Number 6 Region: 38-98
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.3e-16
Family Nucleotide and nucleoside kinases 0.0036
Further Details:      
 
Domain Number 7 Region: 218-257
Classification Level Classification E-value
Superfamily WW domain 0.000000000000108
Family WW domain 0.001
Further Details:      
 
Domain Number 8 Region: 267-303
Classification Level Classification E-value
Superfamily WW domain 0.00000000032
Family WW domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025651   Gene: ENSONIG00000020355   Transcript: ENSONIT00000025672
Sequence length 1404
Comment pep:novel scaffold:Orenil1.0:GL831152.1:5166782:5246981:1 gene:ENSONIG00000020355 transcript:ENSONIT00000025672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFVFTITGSKLTKDLKQYLSQRFQKSSPDHELQQTIRDNLYRHAVPCTTRAPREGEVPGV
DYDFLSVEQFLELEKSGTLLEIGTYDGNYYGTPKPPVQPPSGKVISSSGNSGDAPLPDGL
SSSLPGSQHSTPRRSKSYNDMRNAGLVPGEQQQEDDEDLHDMNSSFTGDSSELDEIHHSV
RPFAPRQSDLSYAGTTPSPPATTESTQQTHTHLSHPPPEDPLGPLPDNWEMAYTENGEVY
FIDHNTRTTSWIDPRCLDKPQKPLEESEDDELPPGWEKIDDPVYGVYYVDHINRKTQYEN
PVLEAKKRRQLEQQQPQPQSQQPPEEWIEDSTMAGAPLASAHLPSRCLLSGPTQLSALGG
KPFFTRNRSELKGTFINTKLKKSRRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMET
GDVIVSVNDTCVLGYTHAQVVKIFQSIPIGSMVNLELCRGYPLPFDPDDPNTSLVTSVAI
LDNKEPIIVNGQETSNSYDSPSSHGSQNNNGPTNSGVPINGLPRPHSPSTEVASDTSSQH
GYPSDVVTLASSIATQPELITVHMEKGDKGFGFTIADSPGGGGQRVKQIVDYPRCRGLRE
GDIIVEVNKRNVQSMSHNQVVDLLSKCPKGSEVTMLVQRGVAPAKKSPKLXQLSRKDSQN
SSQHSVSSHRSAHTDSPVHSSLAPALSESNAPPPPSQPLPGLPIQDSPGDGTIQRKPDPF
KIWAQSRSMYESRRKPPHPPPWQSKGIAPIKKNNHHIHCQVPDFQEQDIFLWRKDTGFGF
RILGGNEPGEPIYIGHIVKYGAADEDGRLRSGDELICVDGTAVVGKSHQLVVQLMQQAAK
QGHVNLTVRRKTTYAVLVKAEGDMPPSPASSHHSSTQAPSFTEDIGKRTPQGSQNSLNTV
SSGSGSTSGIGSGGGGGGPPIATPAVVSSALQPYDVEIRRGENEGFGFVIVSSVSRPEAG
TTFAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNGCSITNKSHSDIVNLIKEAG
NTVTLRIIPGDESSNASLLTNAEKIATITTTHTAQQQAAPEARTNTKPKQESFVPQAAPP
QPPTQQPPSTQDSEFYSVDLERDNKGFGFSLRGGREYNMDLYVLRLAEDGAAVRNGKMMV
GDEILEINGESTKGMKHARAIELIKNGGRRVHLVLKRGDGSVPEYDDSTNNISAANPASG
VQNAAEVNTLPLNDAPSESSDPPELQQSSRSKKEPGRRSHGTGRHTHSNHRHHSPSKKTS
TGKHKGKKSTGKNAPKKKDDKKSDGRHRHRSRHRSPNKGHTRSRSADNVLDDRRGGHRRG
RSPDRRHHRHRSPHRSPHRSPRRLPYRSPHRSPYRSPHRHRSPYRPRQQSPTRRRAQSSD
PYRRYRSPERQTRSNEKPIVDEPV
Download sequence
Identical sequences I3KX05
ENSONIP00000025651 ENSONIP00000025651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]