SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000110 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000110
Domain Number 1 Region: 1026-1124
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-26
Family PDZ domain 0.0000244
Further Details:      
 
Domain Number 2 Region: 251-352
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-25
Family PDZ domain 0.0000144
Further Details:      
 
Domain Number 3 Region: 794-884
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-23
Family PDZ domain 0.000035
Further Details:      
 
Domain Number 4 Region: 626-729
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-21
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 433-540
Classification Level Classification E-value
Superfamily PDZ domain-like 9.73e-20
Family PDZ domain 0.0000764
Further Details:      
 
Domain Number 6 Region: 136-173
Classification Level Classification E-value
Superfamily WW domain 0.000000000000475
Family WW domain 0.0011
Further Details:      
 
Domain Number 7 Region: 183-218
Classification Level Classification E-value
Superfamily WW domain 0.00000000403
Family WW domain 0.0035
Further Details:      
 
Domain Number 8 Region: 2-86
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000673
Family Nucleotide and nucleoside kinases 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000110   Gene: ENSONIG00000000092   Transcript: ENSONIT00000000109
Sequence length 1176
Comment pep:known_by_projection scaffold:Orenil1.0:GL831243.1:1742564:1928974:1 gene:ENSONIG00000000092 transcript:ENSONIT00000000109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEKSGALLESGTYEDNFYGTPKPPAEPSALLLNVTDQLLPGARPSSEGKRKRNKSVSN
MEKASIEPPEEEEEERPIVNGNGVAVTPESSEHEDKSTDASGDVGPQINPAEATSEIPKD
DGQIPKMAVPKPEENDELGPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPE
ECKEDELPYGWEKIDDPIYGSYYVDHINRRTQFENPVLEAKRRLQQQQQMQSQGLSSLPL
PTIYREKPLFTRDPTQLKGSFLSTSLQKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAA
DGKMATGDVIVYINDVCVLGTTHADVVKLFQSVPIGQSVTLVLCRGYPLPYEPEEAANTN
NNTTTIISPLGIMEQRPIMVNGRTGYDNYLDYLTRTARFVTDPSQDPVSAQQQLLTGHPA
DTHLDGSLPPTTGTTPPDSVSMASSGATQGELLTLTMVKGVDGFGFTIADSATGQRVKQV
LEPQGCPGLCEGDLIVEINKQPVQGFSHTQVVELLKECPVGAETCLLVQRGGTGHYSPWK
TPKQVLEQWESQQGQSSPAQTSLSAPVIPHSAPFPTHHLHRASVPESASEALALAKPDPY
DLYEKSRAIFESRHPGQPRTVFPVDSSGGEYQDIEVHLRRQKSGFGFRVLGGDEAGQPVS
PETREKILIGAIIEKSPADLDGRLRPGDELLFVDGIPVVGKPHRYVIDLMHGAARTGQVN
LVIRRRVQAAGESCPENGRSPGSVSTQHSSPRSDFTYGNSTSTPQAPNAGMGNAGMGNAG
STSDGTSNTQPSDVIISRKESEGFGFVIISSLNRPEAATTNTVPHKIGRIIEGSPADRCG
KLKVGDRILAVNNQSIVNMPHADIVKLIKDAGLSVTLRIIPQEEVSNPPSAPSSEKQSPM
AHQHSPKAQLNTAASQSNQAVTEPSPSVSQPNPMPHQSPVTQLPAPTPQTYTHEGSYRSE
VKARQDVKPDIRQPPFTDYRQPPVDYRHPPVADYRQPPTLDYRHPPLLDYRQLATDARQF
AIPEYRMPPVQLTQDFDFFTVELEKSVKGFGFSIRGGREYKMDLFVLRLAEDGPAIRNGR
MRVGDQIIEINGESTRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYGMVSSSLSMCMK
SDKHGSPYFFLTGHSKDTTMPPHGMVVLQPPQACRK
Download sequence
Identical sequences I3IU20
ENSONIP00000000110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]