SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000141 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000141
Domain Number 1 Region: 480-601
Classification Level Classification E-value
Superfamily SH2 domain 9.02e-25
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 2 Region: 605-644
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000471
Family SOCS box-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000141   Gene: ENSONIG00000000114   Transcript: ENSONIT00000000140
Sequence length 671
Comment pep:known_by_projection scaffold:Orenil1.0:GL831280.1:368605:387983:1 gene:ENSONIG00000000114 transcript:ENSONIT00000000140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TESRATLSAPPPPQSSMEAQGFDFAPSPGLRPQLLVFSNIMRNGEGILELDRRNQPRDAL
DQSPGSGCSSPAQQQNLLDRTWGAHSPASVEMQGAAELCHRHRLIATTPEWPVLTERSNP
LAVIDSKWGCATRDREGAVFELARRFGELGVGAVPKMLFKAGELPHCSCQSAHRPAGGGV
EPGDDPTETSDALLVLEGLGNGDVDGLDMDECPEDEADDKMSGAFSISSFQVELRRQVCS
LHGNLSGRLSQVSCGNTEVVTHASAKSPSTTPAQSSPWATSPNLSQASTPRRRPERCASA
PRTPTGRATGGEKMLKVPGKSKKGSLKIRLSKLFRTKSCSGSSHLLDKRPSVTYSVSSAG
SLVDMACAAGAEQDADSHSQPRLTRAHSAFSPASLSASLSTFTGETVSLVDVDISQRGAN
TPHPPTPPPPPRRSLSLLDAFLRALPHSNPSPADAPPPIRQAPPPMLCALRRSEASNFTA
SLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRME
HYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVS
RFSNVKSLQHLCRFCIRQIVRIDHIQELPLPRPLISYLSKFYYYDPEEEMYLSIKSIRRV
VGVGQEAESQT
Download sequence
Identical sequences I3IU51
ENSONIP00000000141 ENSONIP00000000141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]