SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000296 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000296
Domain Number 1 Region: 107-360
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.46e-65
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 369-509
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.42e-22
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 598-634
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000144
Family SOCS box-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000296   Gene: ENSONIG00000000231   Transcript: ENSONIT00000000295
Sequence length 636
Comment pep:known_by_projection scaffold:Orenil1.0:GL831315.1:1021288:1034342:-1 gene:ENSONIG00000000231 transcript:ENSONIT00000000295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRISRSTSSASSLTFDDYSLYSNLSEEELLQLAIERSLTDTHGNTTNTTESNTITAN
NTISANTPSCVQPSHCPDKLNPAARNTNQSCGLSLRYLSNHTELMEEEPLFKAIREGDAS
RVKALAMCPGTNLMLPSKPGWLAVHQAAWFGKETCLRMLLSAQPGMINKRTERGETALLV
AVSREHLGCVEVLLGRGADPDIPNYDKETPLYKACERSNPAIVAVLLNHGVVANTRCIQG
WTALQEAVSRNNVEICEMLLKAGAKHSISNMYGITPLFTAAQSGQLATLRFLLKHGADIN
SQAADGATALYEATKNGHEQVVELLISQNADANKPGKRGLLPLHIAAQRGSDIIVSMLIP
ATSKARVRRTGISPLHMAAERNRDDVLETLIEAGFDVNAQLSEEWSRLYEDRRSTALYFA
VINDNIDAVRMLLTAGANPNLDVFKPLMVAARQGCIQTITLLVEHGAEINATIPTHPTTF
PAVYMFSMKYLPMFKYLLDHGGNALSCFNCVYGSSPHPPIKTSRTERGELHDIDQVVPRR
GIQFCEMISVPSICRWAGPIIDVLLDYVGHVTLCSRLMEHLDSYSEWTCIKEKAAPPRPL
LQLCRLQILQLVGRHRLKKLPLPGGLIRFLQHQELM
Download sequence
Identical sequences I3IUK6
ENSONIP00000000296 ENSONIP00000000296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]