SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000303 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000303
Domain Number 1 Region: 3-215
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.57e-36
Family Ankyrin repeat 0.00026
Further Details:      
 
Domain Number 2 Region: 296-335
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000955
Family SOCS box-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000303   Gene: ENSONIG00000000236   Transcript: ENSONIT00000000302
Sequence length 335
Comment pep:known_by_projection scaffold:Orenil1.0:GL831315.1:1037394:1046570:-1 gene:ENSONIG00000000236 transcript:ENSONIT00000000302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQLLAHKGADINAQAGDGASPLYEASKNGHVSAVEALLTLKADANRPTKAGLLPLHVAVK
NNHARVVSMLIPVTSRIRVQRCGISPLHIAAERNRDEIMELLIEAGFDVNAKLSQDWSRI
YEDHRSTAIYFSVYNGNLEATEMLLVAGANPNLDVFNPLLIAVRLGWVDMAALLLRYGAD
VSAQVSTQLSSFPSAIMLSMDSLPVLKLLLDHGCDAHSCFECSYGQKPHPAIAPSRRPIE
ELQFCEAISSMSFCPTPGPIILMLLDYVSHIRLCSRLVGILESQGDWALIRLKALPPHPL
MQLCRLKIRCLVGVQRLKLLHTLPLPVRLIHFLQY
Download sequence
Identical sequences I3IUL3
ENSONIP00000000303 ENSONIP00000000303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]