SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000607 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000607
Domain Number 1 Region: 342-677
Classification Level Classification E-value
Superfamily L domain-like 2.31e-46
Family Ngr ectodomain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 101-159
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000303
Family VWC domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000000607
Domain Number - Region: 198-294
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0223
Family Extended AAA-ATPase domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000607   Gene: ENSONIG00000000475   Transcript: ENSONIT00000000606
Sequence length 702
Comment pep:known_by_projection scaffold:Orenil1.0:GL831191.1:1865379:1888554:1 gene:ENSONIG00000000475 transcript:ENSONIT00000000606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWWLVVASLWLLVALTIPDAEARNRPRNQNGEILRGRRRRKDGQGFGRARAGRTRPLKI
RLVPGPSIPVVPVEGNALLQQPYKNIQEQHATYNVIPGKQGQCVYQGLTMFDQAVWSPKP
CVTCLCTGGRVVCDESTCPEIHCHFPFTPAGECCPVCMEPDWSTAAVCSVALTSWSEILD
ISGDSPVPNDPSDVVTPLTQEEIQKILWREAEQHLEKEKERREEENERREEEKERREEEN
ERREEENERREEEKERREEENERREEENERREEENERREEENERHEEEKEEQEEEVWLRG
DVFQMLPKEPEEPVNRGGLPPGCDISDVTATCENAKLTHFPPLAIPELKSLSLEGNSISS
IPAGAFNGIPNLEWINLKKNKLTSAGIDSKAFKGLKKLTRLYLDGNLLDVVPSDLPPTLQ
ELKINENRLRGIDENSFQDLSSLVILELEGNLLSEGNVDPLAFAPLIQLSYLRLGRNHFR
TVPQGLPKSLLELYLENNLIEEISETVFNQTSNLNIVSLRHNKLEETRIAPLAWINHRYL
ESIDLSYNKLYMVPSYLPRSLVHLVLLGNNIERIPGYVFAHMQPGLEYLYLSYNKLDGEG
TEPESFFGAYHSLVELCLDHNQLVVVPSGINEMTNLHFLRLDNNMIRSIPDEAICDPNHS
GDSTLVAVRLENNYIDPQKISPMAFSCVRSASSVVLKPQKTK
Download sequence
Identical sequences I3IVG7
ENSONIP00000000607 ENSONIP00000000607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]