SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000773 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000000773
Domain Number - Region: 10-92
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0445
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000773   Gene: ENSONIG00000000608   Transcript: ENSONIT00000000772
Sequence length 163
Comment pep:known_by_projection scaffold:Orenil1.0:GL831191.1:2714423:2728395:1 gene:ENSONIG00000000608 transcript:ENSONIT00000000772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPAINLKAIVLVHWLLTVWGSMVWPPVAFTLANLSVLAVGVWAIAQRDSVDAVIMFLI
GMILTILTDIIHLGIFYPLFPTSNLFRFSTGMAIFNLLLKPVSCFFVYQMYRERGGDYSI
NFGFPSVSRNRDAYQSIDQQDDSSTSGNPFNQTPDSKPGVRTY
Download sequence
Identical sequences I3IVY3
ENSONIP00000000773 XP_003447723.1.78416 ENSONIP00000000773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]